Recombinant Human Myc proto-oncogene protein(MYC),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P01106
Gene Names MYC
Alternative Names Class E basic helix-loop-helix protein 39 (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) (BHLHE39)
Expression Region Partial(169-439aa )
Molecular Weight 61.7 kDa
Protein Sequence SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity MYC
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PEHU1152826

Recombinant Human Myc proto-oncogene protein(MYC),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Myc proto-oncogene protein(MYC),partial
Copyright © 2026-present Echo Bio. All rights reserved.