Specification
| Organism | Zea mays (Maize) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P13689 |
| Gene Names | ABP1 |
| Alternative Names | ERABP1 |
| Expression Region | Full Length of Mature Protein(39-201aa ) |
| Molecular Weight | 22.4 kDa |
| Protein Sequence | SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This is probably a receptor for the plant hormone auxin. |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum lumen |
| Protein Families | |
| Tissue Specificity | ABP1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |