Recombinant Zaire ebolavirus Matrix protein VP40(VP40)

Specification
Organism Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q77DJ6
Gene Names VP40
Alternative Names Membrane-associated protein VP40
Expression Region Full Length(1-326AA )
Molecular Weight 51.2 kDa
Protein Sequence MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. The hexamer form ses to be involved in budding. The octamer form binds RNA, and may play a role in genome replication .
Involvement in Disease
Subcellular Location Virion membrane, Peripheral membrane protein, Host late endosome membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Host endomembrane system, Peripheral membrane protein
Protein Families Filoviridae matrix protein VP40 family
Tissue Specificity VP40
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEZAT762474

Recombinant Zaire ebolavirus Matrix protein VP40(VP40)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Zaire ebolavirus Matrix protein VP40(VP40)
Copyright © 2021-present Echo Biosystems. All rights reserved.