Specification
Organism | Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus) |
Expression Host | Baculovirus |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q77DJ6 |
Gene Names | VP40 |
Alternative Names | Ebola VP40 (eVP40) (Membrane-associated protein VP40) |
Expression Region | Full Length(1-326aa ) |
Molecular Weight | 39.1 |
Protein Sequence | MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | VP40 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |