Specification
Organism | Yersinia pestis |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P26948 |
Gene Names | caf1 |
Alternative Names | caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen |
Expression Region | Full Length of Mature Protein(22-170aa ) |
Molecular Weight | 17.6 kDa |
Protein Sequence | ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | |
Involvement in Disease | |
Subcellular Location | Secreted, capsule |
Protein Families | |
Tissue Specificity | caf1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |