Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

Specification
Organism Yersinia enterocolitica
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P31492
Gene Names yopE
Alternative Names yopE; yop25; Outer membrane virulence protein YopE
Expression Region Full Length(1-219aa )
Molecular Weight 38.9 kDa
Protein Sequence MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis
Involvement in Disease
Subcellular Location Cell outer membrane
Protein Families YopE family
Tissue Specificity yopE
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PCQa23300997

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)
Copyright © 2021-present Echo Biosystems. All rights reserved.