Recombinant Yersinia enterocolitica Attachment invasion locus protein(ail)

Specification
Organism Yersinia enterocolitica
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P16454
Gene Names ail
Alternative Names ailAttachment invasion locus protein
Expression Region Full Length of Mature Protein(24-178aa )
Molecular Weight 33.2 kDa
Protein Sequence ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.
Involvement in Disease
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Ail/OmpX/PagC/Lom family
Tissue Specificity ail
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEYAQ322411

Recombinant Yersinia enterocolitica Attachment invasion locus protein(ail)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Yersinia enterocolitica Attachment invasion locus protein(ail)
Copyright © 2021-present Echo Biosystems. All rights reserved.