Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)

Specification
Organism Xenopus laevis (African clawed frog)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P16176
Gene Names tgfb1
Alternative Names Short name: TGF-beta-1 Alternative name(s): TGF-beta-5
Expression Region Full Length of Mature Protein(271-382aa )
Molecular Weight 28.6 kDa
Protein Sequence GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Important role in certain aspects of differentiation.
Involvement in Disease
Subcellular Location Secreted
Protein Families TGF-beta family
Tissue Specificity tgfb1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEXBE23571

Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)
Copyright © 2026-present Echo Bio. All rights reserved.