Specification
| Organism | Xenopus laevis (African clawed frog) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P22845 |
| Gene Names | h1f0-a |
| Alternative Names | H1-SB H1E Histone H1(0)-1 Histone H5B XlH5B |
| Expression Region | Full Length(1-194aa ) |
| Molecular Weight | 37 kDa |
| Protein Sequence | MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Chromosome |
| Protein Families | Histone H1/H5 family |
| Tissue Specificity | h1f0-a |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |