Specification
| Organism | Woodchuck hepatitis B virus (isolate 8) (WHV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P17401 |
| Gene Names | X |
| Alternative Names | HBx Peptide X pX |
| Expression Region | Full Length(1-141aa ) |
| Molecular Weight | 19.2 kDa |
| Protein Sequence | MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted |
| Involvement in Disease | |
| Subcellular Location | Host cytoplasm, Host nucleus, Host mitochondrion |
| Protein Families | Orthohepadnavirus protein X family |
| Tissue Specificity | X |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
