Specification
| Organism | Vicia faba (Broad bean) (Faba vulgaris) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P16079 |
| Gene Names | LEB6 |
| Alternative Names | Legumin type B acidic chain |
| Expression Region | Partial(1-148aa ) |
| Molecular Weight | 19 kDa |
| Protein Sequence | GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | 11S seed storage protein (globulins) family |
| Tissue Specificity | LEB6 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |