Specification
| Organism | Vibrio vulnificus (strain CMCP6) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal hFc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8DDU2 |
| Gene Names | nfuA |
| Alternative Names | nfuA; VV1_0864; Fe/S biogenesis protein NfuA |
| Expression Region | Full Length(1-194aa ) |
| Molecular Weight | 47 kDa |
| Protein Sequence | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | NfuA family |
| Tissue Specificity | nfuA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |