Specification
| Organism | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P59570 |
| Gene Names | ompK |
| Alternative Names | ompK; OMPK_VIBPA; Outer membrane protein ompK |
| Expression Region | Full Length of Mature Protein(21-266aa ) |
| Molecular Weight | 43.9 kDa |
| Protein Sequence | ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Serves as receptor for a broad-host-range vibriophage, KVP40. |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane |
| Protein Families | Nucleoside-specific channel-forming outer membrane porin (Tsx) (TC 1.B.10) family |
| Tissue Specificity | ompK |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |