Specification
| Organism | Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q86132 |
| Gene Names | p |
| Alternative Names | PProtein C' |
| Expression Region | Full Length(1-67aa ) |
| Molecular Weight | 11.9 kDa |
| Protein Sequence | MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in viral pathogenesis or transmission by insects vectors. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Rhabdoviruses C protein family |
| Tissue Specificity | p |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |