Specification
Organism | Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q8B0I2 |
Gene Names | M |
Alternative Names | M; Matrix protein |
Expression Region | Full Length(1-229aa ) |
Molecular Weight | 33.5 kDa |
Protein Sequence | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shutoff presumably inhibits interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell. |
Involvement in Disease | |
Subcellular Location | Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein, Host nucleus membrane, Peripheral membrane protein |
Protein Families | Vesiculoviruses matrix protein family |
Tissue Specificity | M |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |