Specification
| Organism | Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) |
| Expression Host | Yeast |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P33816 |
| Gene Names | A27L |
| Alternative Names | A27L; A30L14 kDa fusion protein |
| Expression Region | Full length(1-110aa ) |
| Molecular Weight | 15.0 kDa |
| Protein Sequence | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion |
| Involvement in Disease | |
| Subcellular Location | Virion |
| Protein Families | Chordopoxvirinae A27 protein family |
| Tissue Specificity | A27L |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
