Recombinant Variola virus 14 kDa fusion protein(A27L)

Specification
Organism Smallpox virus
Expression Host Mammalian cell
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P33816
Gene Names A27L
Alternative Names A27L; A30L14 kDa fusion protein
Expression Region Full Length(1-110aa )
Molecular Weight 15.0 kDa
Protein Sequence MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).
Involvement in Disease
Subcellular Location Virion
Protein Families Chordopoxvirinae A27 protein family
Tissue Specificity A27L
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$450.00
In stock
SKU
EB-PMVAR335991

Recombinant Variola virus 14 kDa fusion protein(A27L)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Variola virus 14 kDa fusion protein(A27L)
Copyright © 2021-present Echo Biosystems. All rights reserved.