Specification
| Organism | Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0DJ31 |
| Gene Names | N/A |
| Alternative Names | Toxin Vm24 Toxin alpha-KTx 21.1 |
| Expression Region | Full Length(1-36aa ) |
| Molecular Weight | 7.9 kDa |
| Protein Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Short scorpion toxin superfamily, Potassium channel inhibitor family, Alpha-KTx 23 subfamily |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |