Specification
Organism | Vaccinia virus (strain Copenhagen) (VACV) |
Expression Host | Baculovirus |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P20540 |
Gene Names | L1R |
Alternative Names | Virion membrane protein M25 |
Expression Region | Partial(2-183aa ) |
Molecular Weight | 23.2 kDa |
Protein Sequence | GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell (By similarity). |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | L1R |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |