Recombinant Vaccinia virus Protein K3(VACWR034)

Specification
Organism Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P18378
Gene Names VACWR034
Alternative Names Protein K2
Expression Region Full Length(1-88aa )
Molecular Weight 26.6 kDa
Protein Sequence MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Involvement in Disease
Subcellular Location
Protein Families Poxviridae K3 protein family
Tissue Specificity VACWR034
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEVAI323710

Recombinant Vaccinia virus Protein K3(VACWR034)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Vaccinia virus Protein K3(VACWR034)
Copyright © 2021-present Echo Biosystems. All rights reserved.