Specification
| Organism | Vaccinia virus (strain Copenhagen) (VACV) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P21081 |
| Gene Names | E3L |
| Alternative Names | p25 |
| Expression Region | Full Length(1-190aa ) |
| Molecular Weight | 28.5 kDa |
| Protein Sequence | MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Poxviridae E3 protein family |
| Tissue Specificity | E3L |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |