Specification
| Organism | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P68617 |
| Gene Names | VACWR156 |
| Alternative Names | VACWR156; A33RProtein A33 |
| Expression Region | Partial(57-185aa ) |
| Molecular Weight | 16.2 kDa |
| Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Coordinates the incorporation of A36 into wrapped enveloped virion membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. |
| Involvement in Disease | |
| Subcellular Location | Virion membrane, Single-pass type II membrane protein, Host membrane, Single-pass type II membrane protein |
| Protein Families | Chordopoxvirinae A33 protein family |
| Tissue Specificity | VACWR156 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |