Specification
| Organism | Vaccinia virus (strain L-IVP) (VACV) |
| Expression Host | E.coli |
| Protein Tag | C-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P30895 |
| Gene Names | H3L |
| Alternative Names | (Ag35)(Virion envelope protein p35)(Fragments) |
| Expression Region | 1-56aa(X27S,X28S,X29S) |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.274 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-388℃. |
| Protein Length | Partial |
| Molecular Weight | 7.5 kDa |
| Protein Sequence | PEKRNVVVVKDDPDHYKDYAHDKKIDSSSRFIITGNKVKTEKINRQILDNAAKYVE |
Background
| Research Areas | Others |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |