Recombinant Vaccinia virus Complement control protein C3(VACWR025)

Specification
Organism Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P68638
Gene Names VACWR025
Alternative Names 28KDA protein Secretory protein 35 Short name: Protein C3 VCP
Expression Region Full Length of Mature Protein(20-263aa )
Molecular Weight 28.6 kDa
Protein Sequence CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.
Involvement in Disease
Subcellular Location Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Extracellular side, Secreted
Protein Families Receptors of complement activation (RCA) family
Tissue Specificity VACWR025
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYVAI302514

Recombinant Vaccinia virus Complement control protein C3(VACWR025)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Vaccinia virus Complement control protein C3(VACWR025)
Copyright © 2021-present Echo Biosystems. All rights reserved.