Recombinant Tuber borchii Cyanovirin-N homolog

Specification
Organism Tuber borchii (White truffle)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5MK11
Gene Names N/A
Alternative Names Cyanovirin-N homolog; CV-N homolog
Expression Region Full Length(1-103aa )
Molecular Weight 15.4 kDa
Protein Sequence MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Mannose-binding lectin.
Involvement in Disease
Subcellular Location
Protein Families Cyanovirin-N family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PETJE692693

Recombinant Tuber borchii Cyanovirin-N homolog

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Tuber borchii Cyanovirin-N homolog
Copyright © 2026-present Echo Bio. All rights reserved.