Specification
| Organism | Trypanosoma cruzi |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9U6Z1 |
| Gene Names | KMP-11 |
| Alternative Names | KMP11 |
| Expression Region | Full Length(1-92aa ) |
| Molecular Weight | 18.0 kDa |
| Protein Sequence | MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytoskeleton |
| Protein Families | KMP-11 family |
| Tissue Specificity | KMP-11 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |