Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

Specification
Organism Hypocrea jecorina (Trichoderma reesei)
Expression Host Yeast
Tag Info N-terminal 6xHis-sumostar-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P79073
Gene Names hfb2
Alternative Names Hydrophobin II
Expression Region Full Length of Mature Protein(16-86aa )
Molecular Weight 23.2 kDa
Protein Sequence AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Responsible for spore hydrophobicity and protection.
Involvement in Disease
Subcellular Location Spore wall, Secreted, cell wall
Protein Families Cerato-ulmin hydrophobin family
Tissue Specificity hfb2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYEa43044499

Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Trichoderma reesei Hydrophobin-2(hfb2)
Copyright © 2021-present Echo Biosystems. All rights reserved.