Specification
| Organism | TOV-Toxoplasma gondii |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q27003 |
| Gene Names | GRA6 |
| Alternative Names | Antigen p32 (Protein p33) |
| Expression Region | Partial(35-150aa ) |
| Molecular Weight | 38.6 kDa |
| Protein Sequence | NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | GRA6 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |