Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

Specification
Organism Toxocara canis (Canine roundworm)
Expression Host Baculovirus
Tag Info C-terminal 9xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P54190
Gene Names TES-26
Alternative Names Toxocara excretory-secretory antigen 26 Short name: TES-26
Expression Region Full Length of Mature Protein(22-262aa )
Molecular Weight 27.9 kDa
Protein Sequence QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds phosphatidylethanolamine.
Involvement in Disease
Subcellular Location Secreted
Protein Families Phosphatidylethanolamine-binding protein family
Tissue Specificity TES-26
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PBTHA347603

Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)
Copyright © 2021-present Echo Biosystems. All rights reserved.