Specification
Organism | Tityus zulianus(Venezuelan scorpion) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q2NME3 |
Gene Names | N/A |
Alternative Names | PT-beta NaTx14.1 |
Expression Region | Full Length of Mature Protein(21-84aa ) |
Molecular Weight | 14.8 kDa |
Protein Sequence | KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWDRATNRCGR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Strongly affects skeletal muscle channels Nav1.4/SCN4A, poorly affects the neuronal channels Nav1.6/SCN8A and Nav1.2/SCN2A. Induces spastic paralysis of rear limbs, increased salivation, apnea, tachycardia and increased perspiration. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | N/A |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |