Specification
    
        | Organism | Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal 10xHis-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P13087 | 
| Gene Names | N/A | 
| Alternative Names | Miraculin; MIR | 
| Expression Region | Full Length of Mature Protein(30-220aa ) | 
| Molecular Weight | 24.9 kDa | 
| Protein Sequence | DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. | 
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family | 
| Tissue Specificity | N/A | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
