Specification
| Organism | Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P39476 |
| Gene Names | sso7d |
| Alternative Names | 7KDA DNA-binding protein dSso7d |
| Expression Region | Full Length of Mature Protein(2-64aa ) |
| Molecular Weight | 23.1 kDa |
| Protein Sequence | ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | 7 kDa DNA-binding/endoribonuclease P2 family |
| Tissue Specificity | sso7d |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |