Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)

Specification
Organism Streptomyces alboniger
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P13249
Gene Names pac
Alternative Names pac; Puromycin N-acetyltransferase; EC 2.3.-.-
Expression Region Full Length(1-199aa )
Molecular Weight 37.5 kDa
Protein Sequence MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Detoxification of puromycin.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity pac
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PESNI319637

Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)
Copyright © 2021-present Echo Biosystems. All rights reserved.