Specification
Organism | Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q5XCB4 |
Gene Names | rplL |
Alternative Names | rplL; M6_Spy0814; 50S ribosomal protein L7/L12 |
Expression Region | Full Length(1-121aa ) |
Molecular Weight | 32.3 kDa |
Protein Sequence | MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | Bacterial ribosomal protein bL12 family |
Tissue Specificity | rplL |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |