Recombinant Streptococcus pyogenes serotype M5 M protein, serotype 5(emm5)

Specification
Organism Streptococcus pyogenes serotype M5
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P02977
Gene Names emm5
Alternative Names emm5; smp5M protein; serotype 5
Expression Region Full Length of Mature Protein (43-461aa )
Molecular Weight 52.5 kDa
Protein Sequence AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQLEAEQQKLEEQNKISEASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPST
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein is one of the different antigenic serotypes of protein M. Protein M is closely associated with virulence of the bacterium and can render the organism resistant to phagocytosis.
Involvement in Disease
Subcellular Location Secreted, cell wall, Peptidoglycan-anchor
Protein Families M protein family
Tissue Specificity emm5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PESMY356042

Recombinant Streptococcus pyogenes serotype M5 M protein, serotype 5(emm5)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Streptococcus pyogenes serotype M5 M protein, serotype 5(emm5)
Copyright © 2021-present Echo Biosystems. All rights reserved.