Specification
| Organism | Streptococcus pyogenes serotype M28 (strain MGAS6180) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q48RM7 |
| Gene Names | acpS |
| Alternative Names | 4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase) |
| Expression Region | Full Length(1-118aa ) |
| Molecular Weight | 16.7 |
| Protein Sequence | MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | P-Pant transferase superfamily, AcpS family |
| Tissue Specificity | acpS |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |