Specification
Organism | Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) |
Expression Host | E.coli |
Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin Level | |
Biological Activity | |
Uniprot ID | Q04IN8 |
Gene Names | ply |
Alternative Names | (PLY)(Thiol-activated cytolysin) |
Expression Region | 2-471aa(146:A_Missing) |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1506 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1628℃. |
Protein Length | Partial |
Molecular Weight | 60.1 kDa |
Protein Sequence | ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPRMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVAPQTEWKQILDNTEVKAVILGGDPSSGARVVTGKVDMVEDLIQEGSRFTADHPGLPISYTTSFLRDNVVATFQNSTDYVETKVTAYRNGDLLLDHSGAYVAQYYITWDELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |