Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

Specification
Organism Staphylococcus aureus
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06886
Gene Names tst
Alternative Names TSST-1
Expression Region Full Length of Mature Protein(41-234aa )
Molecular Weight 37.9 kDa
Protein Sequence STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Responsible for the symptoms of toxic shock syndrome.
Involvement in Disease
Subcellular Location Secreted
Protein Families Staphylococcal/streptococcal toxin family
Tissue Specificity tst
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEFKZ362098

Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)
Copyright © 2021-present Echo Biosystems. All rights reserved.