Specification
| Organism | Staphylococcus aureus |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q53770 |
| Gene Names | tetM |
| Alternative Names | tetA(M) |
| Expression Region | Partial(1-242aa ) |
| Molecular Weight | 32.1 kDa |
| Protein Sequence | MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, TetM/TetO subfamily |
| Tissue Specificity | tetM |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |