Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2(ssaA2)

Specification
Organism Staphylococcus aureus (strain Mu50 / ATCC 700699)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q99RX4
Gene Names ssaA2
Alternative Names ssaA2; SAV2299; Staphylococcal secretory antigen ssaA2
Expression Region Full Length of Mature Protein(28-267aa )
Molecular Weight 42.7 kDa
Protein Sequence SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Not known; immunogenic protein.
Involvement in Disease
Subcellular Location Secreted
Protein Families
Tissue Specificity ssaA2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PESKX858308

Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2(ssaA2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2(ssaA2)
Copyright © 2021-present Echo Biosystems. All rights reserved.