Specification
Organism | Staphylococcus aureus (strain Mu50 / ATCC 700699) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q99RX4 |
Gene Names | ssaA2 |
Alternative Names | ssaA2; SAV2299; Staphylococcal secretory antigen ssaA2 |
Expression Region | Full Length of Mature Protein(28-267aa ) |
Molecular Weight | 42.7 kDa |
Protein Sequence | SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Not known; immunogenic protein. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | |
Tissue Specificity | ssaA2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |