Specification
| Organism | Staphylococcus aureus (strain Mu50 / ATCC 700699) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99V46 |
| Gene Names | sspB |
| Alternative Names | Staphylococcal cysteine proteinase BStaphylopain B |
| Expression Region | Full Length of Mature Protein(220-393aa ) |
| Molecular Weight | 46.9 kDa |
| Protein Sequence | DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other Extracellular domain proteases is involved in colonization and infection of human tissues . |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Peptidase C47 family |
| Tissue Specificity | sspB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
