Specification
| Organism | Staphylococcus aureus (strain N315) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0A075 |
| Gene Names | hlgB |
| Alternative Names | H-gamma-1 H-gamma-I |
| Expression Region | Full Length of Mature Protein(26-325aa ) |
| Molecular Weight | 36.1 kDa |
| Protein Sequence | AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Aerolysin family |
| Tissue Specificity | hlgB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |