Recombinant Staphylococcus aureus Foldase protein PrsA(prsA)

Specification
Organism Staphylococcus aureus (strain COL)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5HET4
Gene Names prsA
Alternative Names prsA; SACOL1897; Foldase protein PrsA; EC 5.2.1.8
Expression Region Full Length of Mature Protein(21-320aa )
Molecular Weight 49.6 kDa
Protein Sequence CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins.
Involvement in Disease
Subcellular Location Cell membrane, Lipid-anchor
Protein Families PrsA family
Tissue Specificity prsA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEFLB702318

Recombinant Staphylococcus aureus Foldase protein PrsA(prsA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Staphylococcus aureus Foldase protein PrsA(prsA)
Copyright © 2026-present Echo Bio. All rights reserved.