Specification
Organism | Staphylococcus aureus (strain COL) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q5HET4 |
Gene Names | prsA |
Alternative Names | prsA; SACOL1897; Foldase protein PrsA; EC 5.2.1.8 |
Expression Region | Full Length of Mature Protein(21-320aa ) |
Molecular Weight | 49.6 kDa |
Protein Sequence | CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Lipid-anchor |
Protein Families | PrsA family |
Tissue Specificity | prsA |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |