Recombinant Staphylococcus aureus Alpha-hemolysin(hly)

Specification
Organism Staphylococcus aureus (strain NCTC 8325)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q2G1X0
Gene Names hly
Alternative Names Alpha-toxin
Expression Region Full Length of Mature Protein(27-319aa )
Molecular Weight 35.3 kDa
Protein Sequence ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Alpha-toxin binds to the mbrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity .
Involvement in Disease
Subcellular Location Secreted
Protein Families Aerolysin family
Tissue Specificity hly
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYFLF639449

Recombinant Staphylococcus aureus Alpha-hemolysin(hly)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Staphylococcus aureus Alpha-hemolysin(hly)
Copyright © 2021-present Echo Biosystems. All rights reserved.