Specification
Organism | Shigella flexneri |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q83M40 |
Gene Names | adk |
Alternative Names | ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase |
Expression Region | Full Length(1-214aa ) |
Molecular Weight | 43.6 kDa |
Protein Sequence | MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Adenylate kinase family |
Tissue Specificity | adk |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |