Recombinant Shigella flexneri Adenylate kinase(adk)

Specification
Organism Shigella flexneri
Expression Host E.coli
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q83M40
Gene Names adk
Alternative Names ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase
Expression Region Full Length(1-214aa )
Molecular Weight 43.6 kDa
Protein Sequence MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Adenylate kinase family
Tissue Specificity adk
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PESZB769592

Recombinant Shigella flexneri Adenylate kinase(adk)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Shigella flexneri Adenylate kinase(adk)
Copyright © 2021-present Echo Biosystems. All rights reserved.