Specification
| Organism | Ovis aries (Sheep) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07217 |
| Gene Names | GHRH |
| Alternative Names | Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH |
| Expression Region | Full Length(1-44aa ) |
| Molecular Weight | 32.1 kDa |
| Protein Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Glucagon family |
| Tissue Specificity | GHRH |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |