Specification
| Organism | Ovis aries (Sheep) |
| Expression Host | Yeast |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P98135 |
| Gene Names | TGFA |
| Alternative Names | EGF-like TGF Short name: ETGF TGF type 1 |
| Expression Region | Extracellular Domain(24-97aa ) |
| Molecular Weight | 34.9 kDa |
| Protein Sequence | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar |
| Involvement in Disease | |
| Subcellular Location | Transforming growth factor alpha: Secreted, extracellular space, SUBCELLULAR LOCATION: Protransforming growth factor alpha: Cell membrane, Single-pass type I membrane protein |
| Protein Families | |
| Tissue Specificity | TGFA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
