Specification
| Organism | Ovis aries (Sheep) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q6QAT4 |
| Gene Names | B2M |
| Alternative Names | B2MBeta-2-microglobulin |
| Expression Region | Full Length of Mature Protein(21-118aa ) |
| Molecular Weight | 18.6 kDa |
| Protein Sequence | IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Beta-2-microglobulin family |
| Tissue Specificity | B2M |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |