Specification
| Gene Names | S |
| Alternative Names | S glycoprotein;E2;Peplomer protein |
| Organism | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Expression Host | E.coli |
| Molecular Weight | 25.2 kDa |
| Expression Region | Partial(315-535aa(I332V,G339H,K356T,S371L,S373P,S375F,R403K,K417N,N440K,V445H,G446S,N450D,L452M,N460K,S477N,T478K,N481K,△483,E484K,F486P,G496S,Q498R,N501Y,Y505H) ) |
| Expression Region | Tag-Free(Partial ) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Not test. |
| Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MTSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK |
Background
| Research Areas | Cancer |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |