Specification
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Expression Host | E.coli |
| Protein Tag | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P41784 |
| Gene Names | prgI |
| Alternative Names | |
| Expression Region | 1-80aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1084 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1203℃. |
| Protein Length | Full Length |
| Molecular Weight | 56.6 kDa |
| Protein Sequence | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Background
| Research Areas | Others |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |